PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_19937
Common NameKK1_020525
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family Dof
Protein Properties Length: 354aa    MW: 37971.3 Da    PI: 9.7078
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_19937genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.41.8e-3980140262
         zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                    +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  C.cajan_19937  80 QQQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 140
                    7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027019.8E-3482138IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52584138IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-2685138IPR003851Zinc finger, Dof-type
PROSITE patternPS01361086122IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
LSLSHIATIN TTISILKRNS RRHTLFEFIL EKKMLGKCEK TVVMNPPTAS NKWTQAQIDD  60
HKASMGRVME KPSQDLLQQQ QQALKCPRCD SSNTKFCYYN NYSLSQPRHF CKACKRYWTR  120
GGTLRNVPVG GGCRKNKRVK RPNGDASATA NSPPSSSTPS ANSNPPSQAH IDSIASSSTS  180
NHININPLFY GLTSNGNMNV PFPRFNLQSQ MNALGLGFSS GVMSSEASDN GYRSGFSTSN  240
SNNNNNSFLS AYSSIFGGSS STCAPSTPVM ASLLSSTLLQ EKFMGGGVKG DQGGNSFQGL  300
AQLEGNNNNG GGGCQNQMEH VGLSDPNSLY WNAATGLGAW SDQPNIGPSV TSLI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-127AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007159343.11e-137hypothetical protein PHAVU_002G230200g
TrEMBLA0A151UAS20.0A0A151UAS2_CAJCA; Dof zinc finger protein DOF1.4 (Fragment)
STRINGGLYMA07G31870.21e-126(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.25e-36Dof family protein